Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN9 Peptide - C-terminal region

TSPAN9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NET5, NET-5, PP1057

UniProt

O75954

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001161792.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CYEKVKMWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHIHRTGKKYDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1.5 (HIST1H1B) Human Gene Knockout Kit (CRISPR)
KN424189 1 Kit

Histone H1.5 (HIST1H1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CFAP410 (C-term) Rabbit Polyclonal Antibody
AP51137PU-N 400 µL

CFAP410 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mucolipin 3 (MCOLN3) (NM_018298) Human Over-expression Lysate
LC402663 20 µg

Mucolipin 3 (MCOLN3) (NM_018298) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Mercapto-2-pentanone
TRC-M257098-500MG 500 mg

3-Mercapto-2-pentanone

Sign In for Pricing
View Details
Cyanine 7 monosuccinimidyl ester, potassium salt [same as GE Cy7® NHS ester]
290-AAT 1 mg

Cyanine 7 monosuccinimidyl ester, potassium salt [same as GE Cy7® NHS ester]

Sign In for Pricing
View Details
2-Oxaspiro[4.5]decan-8-amine
TRC-O366630-50MG 50 mg

2-Oxaspiro[4.5]decan-8-amine

Sign In for Pricing
View Details