Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS22 Peptide - middle region

MRPS22 Peptide - middle region

Product Specifications

Product Name Alternative

GIBT, GK002, C3orf5, COXPD5, RPMS22, MRP-S22

UniProt

P82650

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_064576.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISK4 rabbit pAb
UB-GEN-8358 100 µL

ISK4 rabbit pAb

Sign In for Pricing
View Details
Recombinant Rabbit Alpha 2-Antiplasmin (a2PI)
RPU56217-01 50 µg

Recombinant Rabbit Alpha 2-Antiplasmin (a2PI)

Sign In for Pricing
View Details
Recombinant Rabbit Alpha 2-Antiplasmin (a2PI)
RPU56217-02 100 µg

Recombinant Rabbit Alpha 2-Antiplasmin (a2PI)

Sign In for Pricing
View Details
Recombinant Rabbit Alpha 2-Antiplasmin (a2PI)
RPU56217-03 1 mg

Recombinant Rabbit Alpha 2-Antiplasmin (a2PI)

Sign In for Pricing
View Details
ELISA Kit For Probable G-protein coupled receptor 97
E8396m 96 Tests

ELISA Kit For Probable G-protein coupled receptor 97

Sign In for Pricing
View Details
H2AX Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1575872 100 µL

H2AX Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details