MRPS22 Peptide - middle region
MRPS22 Peptide - middle region
Product Specifications
Product Name Alternative
GIBT, GK002, C3orf5, COXPD5, RPMS22, MRP-S22
UniProt
P82650
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_064576.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1413311-01 0.02 mg (E-Coli)
Recombinant Neisseria gonorrhoeae Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details MBS1413311-02 0.1 mg (E-Coli)
Recombinant Neisseria gonorrhoeae Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details MBS1413311-03 0.02 mg (Yeast)
Recombinant Neisseria gonorrhoeae Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details MBS1413311-04 0.1 mg (Yeast)
Recombinant Neisseria gonorrhoeae Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details MBS1413311-05 0.02 mg (Baculovirus)
Recombinant Neisseria gonorrhoeae Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details