Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TACR1 Peptide - middle region

TACR1 Peptide - middle region

Product Specifications

Product Name Alternative

SPR, NK1R, NKIR, TAC1R

UniProt

Q4VBL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001049.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCP11L2 Adenovirus (Mouse)
46418054 1.0 mL

TCP11L2 Adenovirus (Mouse)

Sign In for Pricing
View Details
TdTIF1 CRISPR Activation Plasmid (h)
sc-409357-ACT 20 µg

TdTIF1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
MSGN1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
30730066 1.0 µg DNA

MSGN1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Human Cystatin-B, BioActive
MBS141619-01 0.002 mg

Recombinant Human Cystatin-B, BioActive

Sign In for Pricing
View Details
Recombinant Human Cystatin-B, BioActive
MBS141619-02 0.01 mg

Recombinant Human Cystatin-B, BioActive

Sign In for Pricing
View Details
Recombinant Human Cystatin-B, BioActive
MBS141619-03 0.1 mg

Recombinant Human Cystatin-B, BioActive

Sign In for Pricing
View Details