Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF692 Peptide - middle region

ZNF692 Peptide - middle region

Product Specifications

Product Name Alternative

AREBP, Zfp692

UniProt

Q9BU19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129508.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFPPPGEEEGEEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC7A5 Polyclonal Antibody, Cy3 Conjugated
bs-10125R-Cy3 100 µL

SLC7A5 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
FAM73B Protein Vector (Rat) (pPM-C-HA)
PV267680 500 ng

FAM73B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Akt (phospho Thr308) Polyclonal Antibody
RA20875-01 50 µL

Akt (phospho Thr308) Polyclonal Antibody

Sign In for Pricing
View Details
Akt (phospho Thr308) Polyclonal Antibody
RA20875-02 100 µL

Akt (phospho Thr308) Polyclonal Antibody

Sign In for Pricing
View Details
Nmrk1 Mouse shRNA Lentiviral Particle (Locus ID 225994)
TL513672V 500 µL Each

Nmrk1 Mouse shRNA Lentiviral Particle (Locus ID 225994)

Sign In for Pricing
View Details
Phytic acid dodecasodium salt hydrate
M26787-01 200 mg

Phytic acid dodecasodium salt hydrate

Sign In for Pricing
View Details