Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF692 Peptide - middle region

ZNF692 Peptide - middle region

Product Specifications

Product Name Alternative

AREBP, Zfp692

UniProt

Q9BU19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129508.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFPPPGEEEGEEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ATF6A Rabbit Monoclonal Antibody
M00655-1-40μl 40 µL

Anti-ATF6A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RTP4 Rabbit Polyclonal Antibody (BF647)
orb2542570 100 µL

RTP4 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Rabbit Polyclonal PGRMC1 Antibody [CoraFluor 1]
NBP2-36525CL1 0.1 mL

Rabbit Polyclonal PGRMC1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
SARS-CoV-2 Spike Protein Antibody
orb1312087-01 30 µL

SARS-CoV-2 Spike Protein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike Protein Antibody
orb1312087-02 50 μL

SARS-CoV-2 Spike Protein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike Protein Antibody
orb1312087-03 100 µL

SARS-CoV-2 Spike Protein Antibody

Sign In for Pricing
View Details