What is the catalog number for DAZ1 Peptide - middle region?

The catalog number for DAZ1 Peptide - middle region is orb1998942.

What sizes are available for DAZ1 Peptide - middle region?

DAZ1 Peptide - middle region is available in the following size(s): 100 µg.

Is DAZ1 Peptide - middle region in stock?

DAZ1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

DAZ1 Peptide - middle region

Product Specifications

Product Name Alternative

DAZ, SPGY

UniProt

Q86SG3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004072.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NB100-2682PECY55 0.1 mL

Mouse Monoclonal L1CAM Antibody (UJ127.11) [PE/Cy5.5]

Sign In for Pricing

View Details

hAP-5002 50 µg

Sheep Polyclonal anti-human 53BP1

Sign In for Pricing

View Details

836517 1 Pack (1 Panel (s) x 1 Pack)

E/E002/FR3-PP-PHOLUMB-400x200/1-B Facility & Office Signs (No Adhesive)

Sign In for Pricing

View Details

HF998227-01 1 Each

Anti-Human CD4 Antibody (5A8), PE

Sign In for Pricing

View Details

HF998227-02 100 Tests

Anti-Human CD4 Antibody (5A8), PE

Sign In for Pricing

View Details

BS1969-01 50 µL

C-TAK1 (P8) polyclonal antibody

Sign In for Pricing

View Details