Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAZ1 Peptide - middle region

DAZ1 Peptide - middle region

Product Specifications

Product Name Alternative

DAZ, SPGY

UniProt

Q86SG3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004072.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-1 beta/IL-1F2 Antibody (A7F7-R)
NBP3-32464 100 µL

Mouse Monoclonal IL-1 beta/IL-1F2 Antibody (A7F7-R)

Sign In for Pricing
View Details
FASN Adenovirus (Human)
20256051 1.0 mL

FASN Adenovirus (Human)

Sign In for Pricing
View Details
MAPT antibody
70R-6020 50 ug

MAPT antibody

Sign In for Pricing
View Details
EIF5AL3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0671806 1.0 µg DNA

EIF5AL3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Sodium Pyrosulphate AR
646085-01 250 g

Sodium Pyrosulphate AR

Sign In for Pricing
View Details
Sodium Pyrosulphate AR
646085-02 500 g

Sodium Pyrosulphate AR

Sign In for Pricing
View Details