Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALOX5 Peptide - middle region

ALOX5 Peptide - middle region

Product Specifications

Product Name Alternative

5-LO, 5LPG, LOG5, 5-LOX

UniProt

P09917

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000689.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]
TA801814BM 100 µL

FOXP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]

Sign In for Pricing
View Details
Mouse Cyclophilin B (CYPB) ELISA Kit
RDR-CYPB-Mu-01 96 Tests

Mouse Cyclophilin B (CYPB) ELISA Kit

Sign In for Pricing
View Details
Mouse Cyclophilin B (CYPB) ELISA Kit
RDR-CYPB-Mu-02 48 Tests

Mouse Cyclophilin B (CYPB) ELISA Kit

Sign In for Pricing
View Details
Human SCARA3 activation kit by CRISPRa
GA109804 1 Kit

Human SCARA3 activation kit by CRISPRa

Sign In for Pricing
View Details
prothymosin, alpha (PTMA) Rabbit Polyclonal Antibody
AP02227SU-S 20 µL

prothymosin, alpha (PTMA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF647 conjugate, 0.1mg/mL
BNC471786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details