Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALOX5 Peptide - middle region

ALOX5 Peptide - middle region

Product Specifications

Product Name Alternative

5-LO, 5LPG, LOG5, 5-LOX

UniProt

P09917

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000689.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXO4 (NM_005938) Human Recombinant Protein
TP760655 50 µg

FOXO4 (NM_005938) Human Recombinant Protein

Sign In for Pricing
View Details
Thioredoxin domain containing 9 (TXNDC9) (NM_005783) Human Recombinant Protein
TP303291 20 µg

Thioredoxin domain containing 9 (TXNDC9) (NM_005783) Human Recombinant Protein

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF640R conjugate, 0.1mg/mL
BNC403128-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Triethylenephosphoramide-d12
TRC-T776602-1MG 1 mg

Triethylenephosphoramide-d12

Sign In for Pricing
View Details
Recombinant Human IMPA2/IMPase 2 Protein (His Tag)
PKSH032591-01 10 µg

Recombinant Human IMPA2/IMPase 2 Protein (His Tag)

Sign In for Pricing
View Details