Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK10 Peptide - middle region

MAPK10 Peptide - middle region

Product Specifications

Product Name Alternative

JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK

UniProt

P53779

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002744.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish sall1a Rabbit Polyclonal Antibody (Biotin)
orb2571567 200 µL

Zebrafish sall1a Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rb discontinued
541617-01 30ul

Rb discontinued

Sign In for Pricing
View Details
Rb discontinued
541617-02 100 µL

Rb discontinued

Sign In for Pricing
View Details
Ornithine Aminotransferase mitochondrial (OAT) Human ELISA Kit
F5931 96 Tests

Ornithine Aminotransferase mitochondrial (OAT) Human ELISA Kit

Sign In for Pricing
View Details
Interleukin-32
553866 100 µg

Interleukin-32

Sign In for Pricing
View Details
Phospho-PRKAA2 (Thr172) Recombinant Monoclonal Antibody
CSB-RA805325A172phHU-01 50 μL

Phospho-PRKAA2 (Thr172) Recombinant Monoclonal Antibody

Sign In for Pricing
View Details