Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK10 Peptide - middle region

MAPK10 Peptide - middle region

Product Specifications

Product Name Alternative

JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK

UniProt

P53779

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002744.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

12 Cell Culture Inserts+12 Well Plate, 0.4 μm, PC Membrane, Opaque, TC, Sterile, 12/pk, 48/cs
CS0005-724101 1 Each

12 Cell Culture Inserts+12 Well Plate, 0.4 μm, PC Membrane, Opaque, TC, Sterile, 12/pk, 48/cs

Sign In for Pricing
View Details
GM2A (Ganglioside GM2 Activator, Cerebroside Sulfate Activator Protein, GM2-AP, Shingolipid Activator Protein 3, SAP-3)
127391 100 µg

GM2A (Ganglioside GM2 Activator, Cerebroside Sulfate Activator Protein, GM2-AP, Shingolipid Activator Protein 3, SAP-3)

Sign In for Pricing
View Details
DNAJA2 Protein Vector (Human) (pPM-C-HA)
PV012667 500 ng

DNAJA2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PMF1 (NM_007221) Human Over-expression Lysate
LS011243 100 µg

PMF1 (NM_007221) Human Over-expression Lysate

Sign In for Pricing
View Details
C6orf164 Protein Vector (Human) (pPB-N-His)
PV066778 500 ng

C6orf164 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit anti-human Golgi membrane protein 1 polyclonal Antibody, HRP conjugated
MBS719815-01 0.05 mg

Rabbit anti-human Golgi membrane protein 1 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details