Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRMT6 Peptide - N-terminal region

PRMT6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HRMT1L6

UniProt

Q96LA8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060607.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL17C Antibody Picoband® (FITC Conjugate)
A00164-2-FITC 100 µg/Vial

Anti-IL17C Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
Eif2b2 Mouse shRNA Plasmid (Locus ID 217715)
TL510119 1 Kit

Eif2b2 Mouse shRNA Plasmid (Locus ID 217715)

Sign In for Pricing
View Details
pTALETF_v2 NN Plasmid
PVT6204 2 µg

pTALETF_v2 NN Plasmid

Sign In for Pricing
View Details
DMRTA1 (m) -PR
sc-143061-PR 10 µM - 20 µL

DMRTA1 (m) -PR

Sign In for Pricing
View Details
Rat Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) CLIA Kit
MBS2708698-01 24 Strip Well

Rat Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) CLIA Kit

Sign In for Pricing
View Details
Rat Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) CLIA Kit
MBS2708698-02 48 Well

Rat Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) CLIA Kit

Sign In for Pricing
View Details