Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRI Peptide - N-terminal region

SRI Peptide - N-terminal region

Product Specifications

Product Name Alternative

Sor, 2210417O06Rik, 2900070H08Rik

UniProt

Q6P069

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074443.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C1orf76 (FAM163A) activation kit by CRISPRa
GA115683 1 Kit

Human C1orf76 (FAM163A) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CD93/C1QR1 Protein (aa 24-580, His Tag)
PKSH032269-01 10 µg

Recombinant Human CD93/C1QR1 Protein (aa 24-580, His Tag)

Sign In for Pricing
View Details
Recombinant Human CD93/C1QR1 Protein (aa 24-580, His Tag)
PKSH032269-02 50 µg

Recombinant Human CD93/C1QR1 Protein (aa 24-580, His Tag)

Sign In for Pricing
View Details
Acetyl-CoA Carboxylase (ACC) Activity Assay Kit
E-BC-K508-M 96 T (40 samples)

Acetyl-CoA Carboxylase (ACC) Activity Assay Kit

Sign In for Pricing
View Details
FITC Conjugated Griffonia simplicifolia Lectin -GS-II-
F-2402-2 2 mg

FITC Conjugated Griffonia simplicifolia Lectin -GS-II-

Sign In for Pricing
View Details
IQGAP1 Rabbit Polyclonal Antibody
TA377550 100 µL

IQGAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details