Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRI Peptide - N-terminal region

SRI Peptide - N-terminal region

Product Specifications

Product Name Alternative

Sor, 2210417O06Rik, 2900070H08Rik

UniProt

Q6P069

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074443.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNRD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F5]
TA501915AM 100 µL

ZNRD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F5]

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF640R conjugate, 0.1mg/mL
BNC401926-100 1x 100 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rac-Nicotine-1,2',3',4',5',6'-13C6
TRC-N412426-10MG 10 mg

rac-Nicotine-1,2',3',4',5',6'-13C6

Sign In for Pricing
View Details
RHOH Rabbit Polyclonal Antibody
AP01238PU-N 100 µg

RHOH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB508789 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Adenovirus E1A (E1A) Sheep Polyclonal Antibody
AP05003PU-N 100 µg

Adenovirus E1A (E1A) Sheep Polyclonal Antibody

Sign In for Pricing
View Details