Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIT1 Peptide - middle region

CHIT1 Peptide - middle region

Product Specifications

Product Name Alternative

CHI3, CHIT, CHITD

UniProt

Q13231

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243054.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HYI Polyclonal Antibody
MBS8567607-01 0.1 mL

HYI Polyclonal Antibody

Sign In for Pricing
View Details
HYI Polyclonal Antibody
MBS8567607-02 0.1 mL (AF405L)

HYI Polyclonal Antibody

Sign In for Pricing
View Details
HYI Polyclonal Antibody
MBS8567607-03 0.1 mL (AF405S)

HYI Polyclonal Antibody

Sign In for Pricing
View Details
HYI Polyclonal Antibody
MBS8567607-04 0.1 mL (AF610)

HYI Polyclonal Antibody

Sign In for Pricing
View Details
HYI Polyclonal Antibody
MBS8567607-05 0.1 mL (AF635)

HYI Polyclonal Antibody

Sign In for Pricing
View Details
HYI Polyclonal Antibody
MBS8567607-06 0.1 mL (APC)

HYI Polyclonal Antibody

Sign In for Pricing
View Details