Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO1 Peptide - middle region

ANO1 Peptide - middle region

Product Specifications

Product Name Alternative

DOG1, TAOS2, ORAOV2, TMEM16A

UniProt

Q5XXA6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060513.5

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVKLTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wingless Type MMTV Integration Site Family, Member 3 (WNT3) Antibody (Alkaline Phosphatase)
abx449641 100 µg

Wingless Type MMTV Integration Site Family, Member 3 (WNT3) Antibody (Alkaline Phosphatase)

Sign In for Pricing
View Details
ANXA1 (Annexin A1, Annexin I, Annexin-1, Calpactin II, Calpactin-2, Chromobindin-9, Lipocortin I, Phospholipase A2 Inhibitory Protein, p35, ANX1, LPC1)
123349 50 µg

ANXA1 (Annexin A1, Annexin I, Annexin-1, Calpactin II, Calpactin-2, Chromobindin-9, Lipocortin I, Phospholipase A2 Inhibitory Protein, p35, ANX1, LPC1)

Sign In for Pricing
View Details
YARS2 siRNA (Human)
MBS8217128-01 15 nmol

YARS2 siRNA (Human)

Sign In for Pricing
View Details
YARS2 siRNA (Human)
MBS8217128-02 30 nmol

YARS2 siRNA (Human)

Sign In for Pricing
View Details
YARS2 siRNA (Human)
MBS8217128-03 5x 30 nmol

YARS2 siRNA (Human)

Sign In for Pricing
View Details
Hsa-miR-4709-3p miRNA Agomir
CMJ1545-01 5 nmol

Hsa-miR-4709-3p miRNA Agomir

Sign In for Pricing
View Details