TAL1 Peptide - middle region
TAL1 Peptide - middle region
Product Specifications
Product Name Alternative
Hpt, Scl, tal-1, bHLHa17, SCL/tal-1
UniProt
P22091
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001274317.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ISDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1221880-01 0.02 mg (E-Coli)
Recombinant Arthroderma otae Tethering factor for nuclear proteasome STS1 (STS1)
Sign In for Pricing
View Details MBS1221880-02 0.02 mg (Yeast)
Recombinant Arthroderma otae Tethering factor for nuclear proteasome STS1 (STS1)
Sign In for Pricing
View Details MBS1221880-03 0.1 mg (E-Coli)
Recombinant Arthroderma otae Tethering factor for nuclear proteasome STS1 (STS1)
Sign In for Pricing
View Details MBS1221880-04 0.1 mg (Yeast)
Recombinant Arthroderma otae Tethering factor for nuclear proteasome STS1 (STS1)
Sign In for Pricing
View Details MBS1221880-05 0.02 mg (Baculovirus)
Recombinant Arthroderma otae Tethering factor for nuclear proteasome STS1 (STS1)
Sign In for Pricing
View Details MBS1221880-06 0.02 mg (Mammalian-Cell)
Recombinant Arthroderma otae Tethering factor for nuclear proteasome STS1 (STS1)
Sign In for Pricing
View Details