Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAL1 Peptide - middle region

TAL1 Peptide - middle region

Product Specifications

Product Name Alternative

Hpt, Scl, tal-1, bHLHa17, SCL/tal-1

UniProt

P22091

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001274317.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GLO1 Pre-designed siRNA Set A
SI006308A 1 Each

Human GLO1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
IGFBP3 Rabbit Polyclonal Antibody (PE-Cy7)
orb911126 100 µL

IGFBP3 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Vmn1r20 3'UTR GFP Stable Cell Line
TU171864 1.0 mL

Vmn1r20 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Phosphate import ATP-binding protein PstB 2 (pstB2)
MBS1399958-01 0.02 mg (E-Coli)

Recombinant Streptococcus mutans Phosphate import ATP-binding protein PstB 2 (pstB2)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Phosphate import ATP-binding protein PstB 2 (pstB2)
MBS1399958-02 0.02 mg (Yeast)

Recombinant Streptococcus mutans Phosphate import ATP-binding protein PstB 2 (pstB2)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Phosphate import ATP-binding protein PstB 2 (pstB2)
MBS1399958-03 0.1 mg (E-Coli)

Recombinant Streptococcus mutans Phosphate import ATP-binding protein PstB 2 (pstB2)

Sign In for Pricing
View Details