Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMX Peptide - middle region

RBMX Peptide - middle region

Product Specifications

Product Name Alternative

Rbmx, Hnrpg, Rbmxrt

UniProt

Q91VM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001239018.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myc tag Rabbit pAb, BF680 conjugated
orb2446283 100 µL

Myc tag Rabbit pAb, BF680 conjugated

Sign In for Pricing
View Details
Recombinant Human SOCS3, Trx - His tagged
SOCS3-3895H 20 µg

Recombinant Human SOCS3, Trx - His tagged

Sign In for Pricing
View Details
(5-Chloro-4-fluoro-2-methoxyphenyl) boronic acid
ZMB89209-01 50 mg

(5-Chloro-4-fluoro-2-methoxyphenyl) boronic acid

Sign In for Pricing
View Details
(5-Chloro-4-fluoro-2-methoxyphenyl) boronic acid
ZMB89209-02 0.5 g

(5-Chloro-4-fluoro-2-methoxyphenyl) boronic acid

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae surE Protein (aa 1-249) (strain PittEE)
VAng-Lsx03887-500gEcoli 500 µg (E. coli)

Recombinant Haemophilus Influenzae surE Protein (aa 1-249) (strain PittEE)

Sign In for Pricing
View Details
RNF113A Human qPCR Template Standard (NM_006978)
HK206319 1 Kit

RNF113A Human qPCR Template Standard (NM_006978)

Sign In for Pricing
View Details