Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMX Peptide - middle region

RBMX Peptide - middle region

Product Specifications

Product Name Alternative

Rbmx, Hnrpg, Rbmxrt

UniProt

Q91VM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001239018.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PDLIM3 antibody
PAab06283 100 µg

Anti-PDLIM3 antibody

Sign In for Pricing
View Details
POLR2A Antibody
E30AC1169 100 µL

POLR2A Antibody

Sign In for Pricing
View Details
HTR2B (5-hydroxytryptamine (Serotonin) Receptor 2B, 5-HT (2B), 5-HT2B) (HRP)
247331-HRP 100 µL

HTR2B (5-hydroxytryptamine (Serotonin) Receptor 2B, 5-HT (2B), 5-HT2B) (HRP)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS516019 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
RELA Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
38802064 1.0 µg DNA

RELA Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Ptgds (NM_008963) Mouse Tagged Lenti ORF Clone
MR224724L4 10 µg

Ptgds (NM_008963) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details