Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Zona pellucida sperm-binding protein 3 (Zp3)

This Recombinant Mouse Zona pellucida sperm-binding protein 3 (Zp3) spans the amino acid sequence from region 23-351aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Sperm receptor) (Zona pellucida glycoprotein 3) (Zp-3) (Zona pellucida protein C)

UniProt

P10761

Expression Region

23-351aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTLWLLPGGTPTPVGSSSPVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRQGNVSSHPIQPTWVPFRATVSSEEKLAFSLRLMEENWNTEKSAPTFHLGEVAHLQAEVQTGSHLPLQLFVDHCVATPSPLPDPNSSPYHFIVDFHGCLVDGLSESFSAFQVPRPRPETLQFTVDVFHFANSSRNTLYITCHLKVAPANQIPDKLNKACSFNKTSQSWLPVEGDADICDCCSHGNCSNSSSSQFQIHGPRQWSKLVSRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzbromarone-D5
TRC-B185202-50MG 50 mg

Benzbromarone-D5

Sign In for Pricing
View Details
Phenylalanylglycine
TRC-P399360-50MG 50 mg

Phenylalanylglycine

Sign In for Pricing
View Details
Human Fucosyltransferase 2 (FUT2) ELISA Kit
RDR-FUT2-Hu-01 96 Tests

Human Fucosyltransferase 2 (FUT2) ELISA Kit

Sign In for Pricing
View Details
Human Fucosyltransferase 2 (FUT2) ELISA Kit
RDR-FUT2-Hu-02 48 Tests

Human Fucosyltransferase 2 (FUT2) ELISA Kit

Sign In for Pricing
View Details
ZNF69 Mouse Monoclonal Antibody [Clone ID: OTI4A4]
CF808651 100 µg

ZNF69 Mouse Monoclonal Antibody [Clone ID: OTI4A4]

Sign In for Pricing
View Details
Benzethidine Hydrobromide
TRC-B190100-25MG 25 mg

Benzethidine Hydrobromide

Sign In for Pricing
View Details