What is the catalog number for ALDH1A2 Peptide - middle region?

The catalog number for ALDH1A2 Peptide - middle region is orb1999497.

What sizes are available for ALDH1A2 Peptide - middle region?

ALDH1A2 Peptide - middle region is available in the following size(s): 100 µg.

Is ALDH1A2 Peptide - middle region in stock?

ALDH1A2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ALDH1A2 Peptide - middle region

Product Specifications

Product Name Alternative

RALDH2, RALDH2-T, RALDH (II)

UniProt

O94788

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001193826.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP105395 100 µg

TRNAW1 Recombinant Protein (Human)

Sign In for Pricing

View Details

E45M09364 100 µg

ID3 Mouse Monoclonal Antibody [Clone:15F4]

Sign In for Pricing

View Details

379271 5 mg

5-Hydroxyseselin

Sign In for Pricing

View Details

DLR-P4Ha1-Ra-96T 96 Tests

Rat Prolyl-4-Hydroxylase Alpha Polypeptide I (P4Ha1) ELISA Kit

Sign In for Pricing

View Details

MBS6346208-01 0.2 mL

SEPT8, CT (SEPT8, KIAA0202, Septin-8) (APC)

Sign In for Pricing

View Details

MBS6346208-02 5x 0.2 mL

SEPT8, CT (SEPT8, KIAA0202, Septin-8) (APC)

Sign In for Pricing

View Details