Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRD3 Peptide - N-terminal region

DRD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D3DR, ETM1, FET1

UniProt

P35462

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000787.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Map2 Antibody
E031273 100 µg -100 µL

Map2 Antibody

Sign In for Pricing
View Details
USP20 Protein Lysate
OCOA01823-20UG 20 µg

USP20 Protein Lysate

Sign In for Pricing
View Details
APMAP Antibody, Biotin conjugated
CSB-PA884629LD01HU-01 50 µg

APMAP Antibody, Biotin conjugated

Sign In for Pricing
View Details
APMAP Antibody, Biotin conjugated
CSB-PA884629LD01HU-02 100 µg

APMAP Antibody, Biotin conjugated

Sign In for Pricing
View Details
COPE, CT (COPE, Coatomer subunit epsilon, Epsilon-coat protein) (APC)
MBS6287857-01 0.2 mL

COPE, CT (COPE, Coatomer subunit epsilon, Epsilon-coat protein) (APC)

Sign In for Pricing
View Details
COPE, CT (COPE, Coatomer subunit epsilon, Epsilon-coat protein) (APC)
MBS6287857-02 5x 0.2 mL

COPE, CT (COPE, Coatomer subunit epsilon, Epsilon-coat protein) (APC)

Sign In for Pricing
View Details