Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRD3 Peptide - N-terminal region

DRD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D3DR, ETM1, FET1

UniProt

P35462

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000787.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pitpna Rat shRNA Plasmid (Locus ID 29525)
TL710032 1 Kit

Pitpna Rat shRNA Plasmid (Locus ID 29525)

Sign In for Pricing
View Details
Nucleoprotein, Recombinant, Avian Infectious Bronchitis Virus, aa1-409, His-Tag
585586-01 20 µg

Nucleoprotein, Recombinant, Avian Infectious Bronchitis Virus, aa1-409, His-Tag

Sign In for Pricing
View Details
Nucleoprotein, Recombinant, Avian Infectious Bronchitis Virus, aa1-409, His-Tag
585586-02 100 µg

Nucleoprotein, Recombinant, Avian Infectious Bronchitis Virus, aa1-409, His-Tag

Sign In for Pricing
View Details
Ponesimod 25mg
A13307-25 25 mg

Ponesimod 25mg

Sign In for Pricing
View Details
NLK Peptide
DF7575-BP 1 mg

NLK Peptide

Sign In for Pricing
View Details
Human ACO1 (Aconitase 1) ELISA Kit
ELK3265-01 48 Tests

Human ACO1 (Aconitase 1) ELISA Kit

Sign In for Pricing
View Details