Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Swine GM-CSF protein (His Tag)

Product Specifications

Background

Granulocyte-macrophage colony-stimulating factor (GM-CSF) is one of an array of cytokines with pivotal roles in embryo implantation and subsequent development. Several cell lineages in the reproductive tract and gestational tissues synthesise GM-CSF under direction by ovarian steroid hormones and signalling agents originating in male seminal fluid and the conceptus. The pre-implantation embryo, invading placental trophoblast cells and the abundant populations of leukocytes controlling maternal immune tolerance are all subject to GM-CSF regulation. GM-CSF stimulates the differentiation of hematopoietic progenitors to monocytes and neutrophils, and reduces the risk for febrile neutropenia in cancer patients. GM-CSF also has been shown to induce the differentiation of myeloid dendritic cells (DCs) that promote the development of T-helper type 1 immune responses in cognate T cells. As a part of the immune/inflammatory cascade, GM-CSF promotes Th1 biased immune response, angiogenesis, allergic inflammation, and the development of autoimmunity, and thus worthy of consideration for therapeutic target. GM-CSF has been utilized in the clinical management of multiple disease processes. Most recently, GM-CSF has been incorporated into the treatment of malignancies as a sole therapy, as well as a vaccine adjuvant. While the benefits of GM-CSF in this arena have been promising, recent reports have suggested the potential for GM-CSF to induce immune suppression and, thus, negatively impact outcomes in the management of cancer patients.

Abbreviation

GM-CSF

Synonyms

CSF2

UniProt

Q29118

Accession Number

Q29118

Expression System

E.coli

Tag

N-His

Sequence

MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK

Applications

Cell culture

Endotoxin

Please contact us for more information.

Purity

> 98 % as determined by reducing SDS-PAGE.

Bioactivity

Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 3 ng/mL.

Reconstitution

Please refer to the printed manual for detailed information.

Shipping Conditions

This product is provided as lyophilized powder which is shipped with ice packs.

Storage Conditions

Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Calculated Molecular Weight

17.1 kDa

Species

Porcine

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2,2-Trifluoroethyl Trifluoroacetate
TRC-T790310-5G 5 g

2,2,2-Trifluoroethyl Trifluoroacetate

Sign In for Pricing
View Details
CD8a Mouse Monoclonal Antibody (SK1), CF®405S Conjugate - Biotium Choice
P009-405S-500 1x 500 µL

CD8a Mouse Monoclonal Antibody (SK1), CF®405S Conjugate - Biotium Choice

Sign In for Pricing
View Details
Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) (KRT5/3594), CF405S conjugate, 0.1mg/mL
BNC043594-500 1x 500 µL

Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) (KRT5/3594), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Aminopyridine
TRC-A629015-10G 10 g

3-Aminopyridine

Sign In for Pricing
View Details
Paraformaldehyde-D2
TRC-P191402-1G 1 g

Paraformaldehyde-D2

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559503 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details