Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5)

This Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5) spans the amino acid sequence from region 25-261aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Glandular kallikrein K5) (mGK-5) (Tissue kallikrein-5)

UniProt

P15945

Expression Region

25-261aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IFGGFNCEKNSQPWQVAVYRFTKYQCGGVLLNANWVLTAAHCHNDKYQVWLGKNNFFEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVIYEPADDLQCVNFKLLPNEDCVKAHIEKVTDVMLCAGDMDGGKDTCMGDSGGPLICDGVLHGITSWGPSPCGKPNVPGIYTKLIKFNSWIKDTIAKNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF766 Polyclonal Antibody
MBS9432781-01 0.05 mL

ZNF766 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF766 Polyclonal Antibody
MBS9432781-02 0.1 mL

ZNF766 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF766 Polyclonal Antibody
MBS9432781-03 5x 0.1 mL

ZNF766 Polyclonal Antibody

Sign In for Pricing
View Details
TARBP2 ORF Vector (Human) (pORF)
ORF010309 1.0 µg DNA

TARBP2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human D aspartate oxidase (DDO) (NM_004032) AAV Particle
RC212769A1V 250 µL

Human D aspartate oxidase (DDO) (NM_004032) AAV Particle

Sign In for Pricing
View Details
RBPJ (IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining Binding Protein Suppressor of Hairless, CBF-1, J kappa-recombination Signal-binding Protein, RBP-J kappa, Renal Carcinoma Antigen NY-REN-30, MGC61669) (MaxLight 750)
MBS6392219-01 0.1 mL

RBPJ (IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining Binding Protein Suppressor of Hairless, CBF-1, J kappa-recombination Signal-binding Protein, RBP-J kappa, Renal Carcinoma Antigen NY-REN-30, MGC61669) (MaxLight 750)

Sign In for Pricing
View Details