Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Seminal vesicle secretory protein 4 (Svs4)

This Recombinant Mouse Seminal vesicle secretory protein 4 (Svs4) spans the amino acid sequence from region 22-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Seminal vesicle protein 2) (Seminal vesicle secretory protein IV) (SVS IV)

UniProt

P18419

Expression Region

22-113aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KKTKEKFLQSEETVRESFSMGSRGHMSRSSEPEVFVRPQDSIGDEASEEMSSSSSSRRRSKIISSSSDGSNMEGESSYSKRKKSRFSQDALE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Bcl-2-like Protein 2 (BCL2L2) AssayLite™ Antibody (APC Conjugate)
32113-05161 5x 30 µg

Human Bcl-2-like Protein 2 (BCL2L2) AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
RMND5A Mouse Monoclonal Antibody [Clone:3D1]
E45M15836 100 µg

RMND5A Mouse Monoclonal Antibody [Clone:3D1]

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii Palmitoyltransferase ERF2 (ERF2)
MBS7014322-01 0.02 mg

Recombinant Debaryomyces hansenii Palmitoyltransferase ERF2 (ERF2)

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii Palmitoyltransferase ERF2 (ERF2)
MBS7014322-02 0.1 mg

Recombinant Debaryomyces hansenii Palmitoyltransferase ERF2 (ERF2)

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii Palmitoyltransferase ERF2 (ERF2)
MBS7014322-03 5x 0.1 mg

Recombinant Debaryomyces hansenii Palmitoyltransferase ERF2 (ERF2)

Sign In for Pricing
View Details
Anti-CTTNBP2NL Polyclonal Antibody
TMAB-04777-01 50 μL

Anti-CTTNBP2NL Polyclonal Antibody

Sign In for Pricing
View Details