Recombinant Cat Major allergen I polypeptide chain 1 (CH1)
This Recombinant Cat Major allergen I polypeptide chain 1 (CH1) spans the amino acid sequence from region 23-92aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(AG4) (Allergen Cat-1) (Allergen Fel d I-A) (Allergen FdI) (Allergen Fel dI) (allergen Fel d 1-A)
UniProt
P30438
Expression Region
23-92aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Felis catus (Cat) (Felis silvestris catus)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
15.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
EICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP08447PU-N 50 µg
Hsp60 (HSPD1) (150-200) rabbit polyclonal antibody, Purified
Sign In for Pricing
View Details 
AP06828PU-N 50 µg
GPR15 (C-Term, Cytopl. Dom.) rabbit polyclonal antibody, Aff - Purified
Sign In for Pricing
View Details NBP1-72702FR 0.5 mL
Goat Polyclonal Goat anti-Mouse IgG (H+L) Secondary Antibody [DyLight 680]
Sign In for Pricing
View Details K3699106 1.0 µg DNA
Vit sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details