Recombinant Variola virus Pro-variola growth factor (B3R), partial
This Recombinant Variola virus Pro-variola growth factor (B3R), partial spans the amino acid sequence from region 19-100aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(Pro-VGF) (VGF) (Secreted epidermal growth factor-like)
UniProt
P0DOP9
Expression Region
19-100aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Field of Research
Infectious Disease & Virology; Stem Cell & Developmental Biology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
16.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ANSGNAIETTLSEITNTTTDIPAIRLCGPEGDRYCFHGICIHARDIDGMYCRCSHGYTGIRCQHVVLVDYQRSEKPNTTTSY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-89513AF594 0.1 mL
Rabbit Monoclonal TRAILR2/TNFRSF10B Antibody (102) [Alexa Fluor 594]
Sign In for Pricing
View Details