Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus 3 beta-hydroxysteroid dehydrogenase/Delta 5——》4-isomerase (VACWR170)

This Recombinant Vaccinia virus 3 beta-hydroxysteroid dehydrogenase/Delta 5——》4-isomerase (VACWR170) spans the amino acid sequence from region 1-346aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(3-beta-HSD) (5) (3-beta-hydroxy-5-ene steroid dehydrogenase) (Progesterone reductase) (Delta-5-3-ketosteroid isomerase)

UniProt

P26670

Expression Region

1-346aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVYAVTGGAGFLGRYIVKLLISADDVQEIRVIDIVEDPQPITSKVKVINYIQCDINDFDKVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAACVDLGIKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVYAKSKRMAEQLVMKANNSVIMNGAKLYTCCLRPTGIYGEGDKLTKVFYEQCKQHGNIMYRTVDDDAVHSRVYVGNVAWMHVLAAKYIQYPGSEIKGNAYFCYDYSPSCSYDMFNLLLMKPLGIEQGSRIPRWMLKMYACKNDMKRILFRKPSLLNNYTLKISNTTFEVRTNNAELDFNYSPIFNVDVAFERTRKWLEESE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-100 1x 100 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF647 conjugate, 0.1mg/mL
BNC471812-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1059), CF647 conjugate, 0.1mg/mL
BNC471059-100 1x 100 µL

CD71 (TFRC/1059), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details