Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Amaranthus caudatus Antimicrobial peptide 2

This Recombinant Amaranthus caudatus Antimicrobial peptide 2 spans the amino acid sequence from region 26-55aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(AMP2) (AMP1)

UniProt

P27275

Expression Region

26-55aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Amaranthus caudatus (Love-lies-bleeding) (Inca-wheat)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGECVRGRCPSGMCCSQFGYCGKGPKYCGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMBRA1 Rabbit Polyclonal Antibody
TA373481 100 µL

AMBRA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Pyrrolidinecarbodithioic Acid Ammonium Salt
TRC-P997985-15G 15 g

1-Pyrrolidinecarbodithioic Acid Ammonium Salt

Sign In for Pricing
View Details
RAB10 Human Gene Knockout Kit (CRISPR)
KN201464RB 1 Kit

RAB10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GATA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10G7]
TA809219AM 100 µL

GATA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10G7]

Sign In for Pricing
View Details
CPS1 Mouse Monoclonal Antibody [Clone ID: OTI7B6]
CF813538 100 µg

CPS1 Mouse Monoclonal Antibody [Clone ID: OTI7B6]

Sign In for Pricing
View Details
Rapamycin-d3 (contains d0) Technical Grade
TRC-R124002-1MG 1 mg

Rapamycin-d3 (contains d0) Technical Grade

Sign In for Pricing
View Details