Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Amaranthus caudatus Antimicrobial peptide 2

This Recombinant Amaranthus caudatus Antimicrobial peptide 2 spans the amino acid sequence from region 26-55aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(AMP2) (AMP1)

UniProt

P27275

Expression Region

26-55aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Amaranthus caudatus (Love-lies-bleeding) (Inca-wheat)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGECVRGRCPSGMCCSQFGYCGKGPKYCGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Influenza A HA1 (H1N1) (A/Beijing/262/95), 18-344aa) protein IgG
HA1H013-M 100 µL

Anti-Influenza A HA1 (H1N1) (A/Beijing/262/95), 18-344aa) protein IgG

Sign In for Pricing
View Details
UVRAG Protein Vector (Human) (pPB-C-His)
PV045585 500 ng

UVRAG Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Gast Mouse qPCR Template Standard (NM_010257)
MK203984 1 Kit

Gast Mouse qPCR Template Standard (NM_010257)

Sign In for Pricing
View Details
NAV3 Rabbit Polyclonal Antibody (Fluoro550)
orb3099987 100 µg

NAV3 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Recombinant Clostridium Tetani tilS Protein (aa 1-467)
VAng-Lsx01817-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Tetani tilS Protein (aa 1-467)

Sign In for Pricing
View Details
ZN160
496143 100 µL

ZN160

Sign In for Pricing
View Details