Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human adenovirus C serotype 5 Early E1A protein

This Recombinant Human adenovirus C serotype 5 Early E1A protein spans the amino acid sequence from region 1-289aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Early E1A 32 kDa protein)

UniProt

P03255

Expression Region

1-289aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGEEFVLDYVEHPGHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lumacaftor acyl-β-D-glucuronide
GC4054-25mg 25 mg

Lumacaftor acyl-β-D-glucuronide

Sign In for Pricing
View Details
CBFB (NM_001755) Human Tagged Lenti ORF Clone
RC202111L2 10 µg

CBFB (NM_001755) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CLN6 CRISPR Activation Plasmid (m2)
sc-429353-ACT-2 20 µg

CLN6 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Plant Nucleoporin 205kDa (NUP205) ELISA Kit
MBS9376314 Inquire

Plant Nucleoporin 205kDa (NUP205) ELISA Kit

Sign In for Pricing
View Details
PRKAA2
553181 100 µL

PRKAA2

Sign In for Pricing
View Details
Beta TRCP Antibody
orb1336635 100 µg

Beta TRCP Antibody

Sign In for Pricing
View Details