Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus mutans serotype c Glucosyltransferase-I (gtfB), partial

This Recombinant Streptococcus mutans serotype c Glucosyltransferase-I (gtfB), partial spans the amino acid sequence from region 426-597aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GTF-I) (Dextransucrase) (Sucrose 6-glucosyltransferase)

UniProt

P08987

Expression Region

426-597aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WLHFLMNFGNIYANDPDANFDSIRVDAVDNVDADLLQIAGDYLKAAKGIHKNDKAANDHLSILEAWSDNDTPYLHDDGDNMINMDNKLRLSLLFSLAKPLNQRSGMNPLITNSLVNRTDDNAETAAVPSYSFIRAHDSEVQDLIRDIIKAEINPNVVGYSFTMEEIKKAFEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP37 (NM_020935) Human Tagged ORF Clone Lentiviral Particle
RC223407L2V 200 µL

USP37 (NM_020935) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human HADHSC AssayLite™ Antibody (RPE Conjugate)
33154-05151 5x 30 µg

Human HADHSC AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
Angiopoietin 1 Rabbit Monoclonal Antibody [KD Validation]
E51K8536 40 µL

Angiopoietin 1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
ADORA1, CT (ADORA1, Adenosine receptor A1) (Biotin)
MBS6271851-01 0.2 mL

ADORA1, CT (ADORA1, Adenosine receptor A1) (Biotin)

Sign In for Pricing
View Details
ADORA1, CT (ADORA1, Adenosine receptor A1) (Biotin)
MBS6271851-02 5x 0.2 mL

ADORA1, CT (ADORA1, Adenosine receptor A1) (Biotin)

Sign In for Pricing
View Details
Anti-TRIF/TICAM1 Antibody Picoband®, FITC Conjugate
PA2001-FITC 100 µg

Anti-TRIF/TICAM1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details