Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Integration host factor subunit alpha (ihfA)

This Recombinant Escherichia coli Integration host factor subunit alpha (ihfA) spans the amino acid sequence from region 2-99aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IHF-alpha)

UniProt

P0A6X7

Expression Region

2-99aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apc11 Blocking Peptide
MBS9631989-01 1 mg

Apc11 Blocking Peptide

Sign In for Pricing
View Details
Apc11 Blocking Peptide
MBS9631989-02 5x 1 mg

Apc11 Blocking Peptide

Sign In for Pricing
View Details
SETDB1 (SET Domain Bifurcated 1, Histone-lysine N-methyltransferase SETDB1, ERG-associated Protein with SET Domain, ESET, Histone H3-K9 Methyltransferase 4, H3-K9-HMTase 4, KG1T, KIAA0067, Lysine N-methyltransferase 1E, KMT1E, TDRD21) (PE)
133210-PE 100 µL

SETDB1 (SET Domain Bifurcated 1, Histone-lysine N-methyltransferase SETDB1, ERG-associated Protein with SET Domain, ESET, Histone H3-K9 Methyltransferase 4, H3-K9-HMTase 4, KG1T, KIAA0067, Lysine N-methyltransferase 1E, KMT1E, TDRD21) (PE)

Sign In for Pricing
View Details
Monoclonal Antibody to Glucagon Like Peptide 1 (GLP1)
TRV-0034718-01 20 µL

Monoclonal Antibody to Glucagon Like Peptide 1 (GLP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Glucagon Like Peptide 1 (GLP1)
TRV-0034718-02 100 µL

Monoclonal Antibody to Glucagon Like Peptide 1 (GLP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Glucagon Like Peptide 1 (GLP1)
TRV-0034718-03 200 µL

Monoclonal Antibody to Glucagon Like Peptide 1 (GLP1)

Sign In for Pricing
View Details