Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Lipopolysaccharide assembly protein B (yciM), partial

This Recombinant Escherichia coli Lipopolysaccharide assembly protein B (yciM), partial spans the amino acid sequence from region 17-389aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0AB58

Expression Region

17-389aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WYMGRRSAQQNKQDEANRLSRDYVAGVNFLLSNQQDKAVDLFLDMLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESASLTYEQRLLAIQQLGRDYMAAGLYDRAEDMFNQLTDETDFRIGALQQLLQIYQATSEWQKAIDVAERLVKLGKDKQRVEIAHFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVSETLEMLQTCYQQLGKTAEWAEFLQRAVEENTGADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLNEAEEGRAKESLMVLRDMVGEKVRSKPRYRCQKCGFTAYTLYWHCPSCRAWSTIKPIRGLDGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LOC114841035 activation kit by CRISPRa
GA120101 1 Kit

Human LOC114841035 activation kit by CRISPRa

Sign In for Pricing
View Details
BBS2 (NM_031885) Human Over-expression Lysate
LY403124 100 µg

BBS2 (NM_031885) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human 2B4/CD244 Protein (His Tag)
PKSH032784-01 10 µg

Recombinant Human 2B4/CD244 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human 2B4/CD244 Protein (His Tag)
PKSH032784-02 50 µg

Recombinant Human 2B4/CD244 Protein (His Tag)

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561044 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
LIPM (NM_001128215) Human Over-expression Lysate
LY426929 100 µg

LIPM (NM_001128215) Human Over-expression Lysate

Sign In for Pricing
View Details