Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated

This Recombinant Escherichia coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated spans the amino acid sequence from region 1-164aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0A8W9

Expression Region

1-164aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEMTNAQRLILSNQYKMMTMLDPANAERYRRLQTIIERGYGLQMRELDREFGELKEETCRTIIDIMEMYHALHVSWSNLQDQQSIDERRVTFLGFDAATEARYLGYVRFMVNVEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIINA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-500 1x 500 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details