Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O157:H7 Outer membrane protein assembly factor BamA (bamA), partial

This Recombinant Escherichia coli O157:H7 Outer membrane protein assembly factor BamA (bamA), partial spans the amino acid sequence from region 421-810aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P0A942

Expression Region

421-810aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
BNC470029-100 1x 100 µL

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (CDH16/1071), CF740 conjugate, 0.1mg/mL
BNC741071-500 1x 500 µL

Ksp-Cadherin / CDH16 (CDH16/1071), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF647 conjugate, 0.1mg/mL
BNC471761-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details