Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Leghemoglobin C2

This Recombinant Glycine max Leghemoglobin C2 spans the amino acid sequence from region 2-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P02236

Expression Region

2-145aa

Tag

N-terminal 6xHis-tagged and C-terminal HA-tagged

Source

E.coli

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uric Acid
TRC-U829200-1G 1 g

Uric Acid

Sign In for Pricing
View Details
AF647-Goat Anti-Mouse IgM (H+L)
RD90765A-01 120 μL

AF647-Goat Anti-Mouse IgM (H+L)

Sign In for Pricing
View Details
AF647-Goat Anti-Mouse IgM (H+L)
RD90765A-02 500 µL

AF647-Goat Anti-Mouse IgM (H+L)

Sign In for Pricing
View Details
AF647-Goat Anti-Mouse IgM (H+L)
RD90765A-03 1 mL

AF647-Goat Anti-Mouse IgM (H+L)

Sign In for Pricing
View Details
VCP (NM_007126) Human Over-expression Lysate
LC402095 20 µg

VCP (NM_007126) Human Over-expression Lysate

Sign In for Pricing
View Details
PerCP Anti-Human CD38 Antibody[HIT2]
E-AB-F1058F-01 20 Tests

PerCP Anti-Human CD38 Antibody[HIT2]

Sign In for Pricing
View Details