Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Leghemoglobin C2

This Recombinant Glycine max Leghemoglobin C2 spans the amino acid sequence from region 2-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P02236

Expression Region

2-145aa

Tag

N-terminal 6xHis-tagged and C-terminal HA-tagged

Source

E.coli

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF1 Human Gene Knockout Kit (CRISPR)
KN416684 1 Kit

TAF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Scn5a Mouse Gene Knockout Kit (CRISPR)
KN515388 1 Kit

Scn5a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TOX3 (TOX3/1123), CF740 conjugate, 0.1mg/mL
BNC741123-100 1x 100 µL

TOX3 (TOX3/1123), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTD016 (RNFT1) Human Gene Knockout Kit (CRISPR)
KN423569 1 Kit

PTD016 (RNFT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF640R conjugate, 0.1mg/mL
BNC401481-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Cervix
CR561176 5 µg

Tissue Total RNA, Cervix

Sign In for Pricing
View Details