Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus 1 Protein Rev (rev) (P93S, X94V)

This Recombinant Human immunodeficiency virus 1 Protein Rev (rev) (P93S, X94V) spans the amino acid sequence from region 1-117aa (P93S, X94V) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A0H4LST7

Expression Region

1-117aa (P93S, X94V)

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human immunodeficiency virus 1

Field of Research

Infectious Disease & Virology; Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGRSGSTDEELLRAVRIINILYQSNPYPSTEGGTRQTRKNRRRRWRARQRQIRAICERILSSCVGRSTEPVPLQLPPLERLKLDCSEDCGTSVETGVGRPQISGESSVVLGSGTKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMG 337
TRC-A576575-5MG 5 mg

AMG 337

Sign In for Pricing
View Details
Stanniocalcin 2 (STC2) (N-term) Rabbit Polyclonal Antibody
AP11418PU-N 400 µL

Stanniocalcin 2 (STC2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPL7A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D5]
TA811794AM 100 µL

RPL7A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D5]

Sign In for Pricing
View Details
TGF beta Receptor I (TGFBR1) Human Gene Knockout Kit (CRISPR)
KN419514 1 Kit

TGF beta Receptor I (TGFBR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
7Alpha-Hydroxy Cholesterol
TRC-H917990-5MG 5 mg

7Alpha-Hydroxy Cholesterol

Sign In for Pricing
View Details
Abrocitinib
TRC-A299840-25MG 25 mg

Abrocitinib

Sign In for Pricing
View Details