Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus 1 Protein Rev (rev)

This Recombinant Human immunodeficiency virus 1 Protein Rev (rev) spans the amino acid sequence from region 1-107aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

V9MMW3

Expression Region

1-107aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Human immunodeficiency virus 1

Field of Research

Infectious Disease & Virology; Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGGNEDRDEELLRAVRIIKILYQSNPYPEPRGTRQARKNRRRRWRARQRQIHSISERILSACLGRPAEPVPLQLPPIERLHISGSESVGTSGTQQSQGTTEGVGSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RGL2 Antibody
NBP3-18514 100 µg

Rabbit Polyclonal RGL2 Antibody

Sign In for Pricing
View Details
Syt8 (NM_018802) Mouse Tagged ORF Clone Lentiviral Particle
MR223665L3V 200 µL

Syt8 (NM_018802) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human HAVCR2 / Hepatitis A virus cellular receptor 2 Recombinant Protein
R13657h 1 Each

Human HAVCR2 / Hepatitis A virus cellular receptor 2 Recombinant Protein

Sign In for Pricing
View Details
GMEB2 siRNA (Rat)
MBS8219923-01 15 nmol

GMEB2 siRNA (Rat)

Sign In for Pricing
View Details
GMEB2 siRNA (Rat)
MBS8219923-02 30 nmol

GMEB2 siRNA (Rat)

Sign In for Pricing
View Details
GMEB2 siRNA (Rat)
MBS8219923-03 5x 30 nmol

GMEB2 siRNA (Rat)

Sign In for Pricing
View Details