Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse GA-binding protein alpha chain (Gabpa)

This Recombinant Mouse GA-binding protein alpha chain (Gabpa) spans the amino acid sequence from region 1-454aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GABP subunit alpha)

UniProt

Q00422

Expression Region

1-454aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

78.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISYQGMEPKLNILEIVKTAETVEVVIDPDAHHAEAEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERLGIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVPPATPTTIKVINSSAKAAKVQRSPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVIECEQKKLARMQLHGIAQPVTAVALAATSLQADKEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DNAJB7 shRNA (UAS) - Lentiviral human DNAJB7 shRNA (UAS, iRFP) (100)
GTR15309390 1 Vial

Lentiviral human DNAJB7 shRNA (UAS) - Lentiviral human DNAJB7 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
GTF3C5 (General Transcription Factor 3C Polypeptide 5, TF3C-epsilon, Transcription Factor IIIC 63kD Subunit, Transcription Factor IIIC Subunit epsilon) (HRP)
MBS6152809-01 0.1 mL

GTF3C5 (General Transcription Factor 3C Polypeptide 5, TF3C-epsilon, Transcription Factor IIIC 63kD Subunit, Transcription Factor IIIC Subunit epsilon) (HRP)

Sign In for Pricing
View Details
GTF3C5 (General Transcription Factor 3C Polypeptide 5, TF3C-epsilon, Transcription Factor IIIC 63kD Subunit, Transcription Factor IIIC Subunit epsilon) (HRP)
MBS6152809-02 5x 0.1 mL

GTF3C5 (General Transcription Factor 3C Polypeptide 5, TF3C-epsilon, Transcription Factor IIIC 63kD Subunit, Transcription Factor IIIC Subunit epsilon) (HRP)

Sign In for Pricing
View Details
VacA (FITC)
581055-01 50 µg

VacA (FITC)

Sign In for Pricing
View Details
VacA (FITC)
581055-02 100 µg

VacA (FITC)

Sign In for Pricing
View Details
4- (8-Methyl-4-oxo-3,4-dihydroquinazolin-3-yl) butanoic acid
DKB21773-01 100 mg

4- (8-Methyl-4-oxo-3,4-dihydroquinazolin-3-yl) butanoic acid

Sign In for Pricing
View Details