Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 Protein Tat (tat)

This Recombinant Human immunodeficiency virus 1 Protein Tat (tat) spans the amino acid sequence from region 1-103aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A0H4LW18

Expression Region

1-103aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human immunodeficiency virus 1

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEPVDPNLEPWNHPGSQPKTACNTCYCKKCCWHCQICFLKKGLGISYGRKKRKHRRGTPQSSKDHQHPIPKQSLPINRGRNPTDPKESKKKVASKAETDPCDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) HT1 Polyclonal Antibody
MBS7192714 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) HT1 Polyclonal Antibody

Sign In for Pricing
View Details
C1D Polyclonal Antibody
A56635-100 100 µL

C1D Polyclonal Antibody

Sign In for Pricing
View Details
Goat Neurolysin, mitochondrial (NLN) ELISA kit
GTR10474107 96 Well

Goat Neurolysin, mitochondrial (NLN) ELISA kit

Sign In for Pricing
View Details
NIPA2 (NM_001184888) Human Over-expression Lysate
LY432908 100 µg

NIPA2 (NM_001184888) Human Over-expression Lysate

Sign In for Pricing
View Details
Caffeic acid
GP1593-25g 25 g

Caffeic acid

Sign In for Pricing
View Details
IFNL1 Polyclonal Antibody
A56703-050 50 µL

IFNL1 Polyclonal Antibody

Sign In for Pricing
View Details