Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)
This Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr) spans the amino acid sequence from region 1-96aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(R ORF protein) (Viral protein R)
UniProt
O12160
Expression Region
1-96aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) (HIV-1)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHGLGQHIYETYGDTWTGVEAIIRILQRLLFVHFRIGCQHSRIGILRQRRARNGASRS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E2261Mo-01 48 Well
Mouse MIP18 family protein FAM96A, FAM96A ELISA KIT
Sign In for Pricing
View Details E2261Mo-02 96 Well
Mouse MIP18 family protein FAM96A, FAM96A ELISA KIT
Sign In for Pricing
View Details E2261Mo-03 5x 96 Tests
Mouse MIP18 family protein FAM96A, FAM96A ELISA KIT
Sign In for Pricing
View Details E2261Mo-04 10x 96 Tests
Mouse MIP18 family protein FAM96A, FAM96A ELISA KIT
Sign In for Pricing
View Details