Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog B-lymphocyte antigen CD20 (MS4A1), partial

This Recombinant Canis lupus familiaris B-lymphocyte antigen CD20 (MS4A1), partial spans the amino acid sequence from region 210-297aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Membrane-spanning 4-domains subfamily A member 1) (CD antigen CD20)

UniProt

Q3C2E2

Expression Region

210-297aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIVENEWKKLCSKPKSDVVVLLAAEEKKEQPIETTEEMVELTEIASQPKKEEDIEIIPVQEEEGELEINFAEPPQEQESSPIENDSIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Igfbp5 ORF Vector (Rat) (pORF)
ORF068551 1.0 µg DNA

Igfbp5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Mouse Arginase 1 Protein, His-SUMO, E.coli-1mg
QP7724-ec-1mg 1mg

Recombinant Mouse Arginase 1 Protein, His-SUMO, E.coli-1mg

Sign In for Pricing
View Details
Rat TTN ELISA Kit
ERT0559 96 Tests

Rat TTN ELISA Kit

Sign In for Pricing
View Details
G-Protein Gi alpha1/alpha2 (Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 / Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2) (PE)
G8599-05A-PE 100 µL

G-Protein Gi alpha1/alpha2 (Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 / Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2) (PE)

Sign In for Pricing
View Details
Rabbit anti-human glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 polyclonal Antibody
MBS714748-01 0.1 mL

Rabbit anti-human glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 polyclonal Antibody
MBS714748-02 5x 0.1 mL

Rabbit anti-human glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 polyclonal Antibody

Sign In for Pricing
View Details