Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interleukin-17A (Il17a)

This Recombinant Rat Interleukin-17A (Il17a) spans the amino acid sequence from region 18-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8)

UniProt

Q61453

Expression Region

18-150aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFNA5 Antibody
A10684-50UG 50 µg

EFNA5 Antibody

Sign In for Pricing
View Details
Human ACTR3C Pre-designed siRNA Set B
SI000229B 1 Each

Human ACTR3C Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Monoclonal CD9 Antibody (MM0180-5H15) [PE/Cy5.5]
NBP2-12184PECY55 0.1 mL

Mouse Monoclonal CD9 Antibody (MM0180-5H15) [PE/Cy5.5]

Sign In for Pricing
View Details
MARK2 (NM_001163297) Human Tagged Lenti ORF Clone
RC228550L4 10 µg

MARK2 (NM_001163297) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FOP antibody
70R-50851 100 ul

FOP antibody

Sign In for Pricing
View Details
TEPP siRNA (Rat)
CRR4181-01 15 nmol

TEPP siRNA (Rat)

Sign In for Pricing
View Details