Recombinant Mouse Fanconi-associated nuclease 1 (Fan1), partial
This Recombinant Mouse Fanconi-associated nuclease 1 (Fan1), partial spans the amino acid sequence from region 893-1020aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(FANCD2/FANCI-associated nuclease 1) (mFAN1) (Myotubularin-related protein 15)
UniProt
Q69ZT1
Expression Region
893-1020aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
21.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
IHSAPAESLRAWVGEAWQAQQGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRRLAADFRHCRGGLPDLVVWNSQSHHCKLVEVKGPSDRLSCKQMIWLYELQKLGADVEVCHVVAVGAKSKGLG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4869405 3x 1.0 µg
Pds5a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
![Recombinant Escherichia coli UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (lpxC)](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
MBS1238666-01 0.02 mg (E-Coli)
Recombinant Escherichia coli UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (lpxC)
Sign In for Pricing
View Details MBS1238666-02 0.02 mg (Yeast)
Recombinant Escherichia coli UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (lpxC)
Sign In for Pricing
View Details MBS1238666-03 0.1 mg (E-Coli)
Recombinant Escherichia coli UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (lpxC)
Sign In for Pricing
View Details