Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein GPR107 (GPR107), partial

This Recombinant Human Protein GPR107 (GPR107), partial spans the amino acid sequence from region 40-263aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Lung seven transmembrane receptor 1)

UniProt

Q5VW38

Expression Region

40-263aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEIPLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARP 100 25mg
A15292-25 25 mg

ARP 100 25mg

Sign In for Pricing
View Details
Recombinant Mouse Serum albumin(Alb), partial
AP74163-01 20 µg

Recombinant Mouse Serum albumin(Alb), partial

Sign In for Pricing
View Details
Recombinant Mouse Serum albumin(Alb), partial
AP74163-02 100 µg

Recombinant Mouse Serum albumin(Alb), partial

Sign In for Pricing
View Details
Recombinant Mouse Serum albumin(Alb), partial
AP74163-03 1 mg

Recombinant Mouse Serum albumin(Alb), partial

Sign In for Pricing
View Details
TRNAE4 Protein Vector (Human) (pPM-C-HA)
48007021 500 ng

TRNAE4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Collagen Type II (Biotin)
MBS6507310-01 0.1 mg

Collagen Type II (Biotin)

Sign In for Pricing
View Details